PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1DL_D550418641.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family WRKY
Protein Properties Length: 96aa    MW: 11367.7 Da    PI: 9.4278
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1DL_D550418641.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY99.22.5e-311068159
                            ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                    WRKY  1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                            ldDgy+WrKYG+K+vk+s++pr+YYrC+++gC+vkk+ver+++dp +v++tYeg+H h 
  Traes_1DL_D550418641.2 10 LDDGYKWRKYGKKSVKNSPNPRNYYRCSTEGCSVKKRVERDRDDPAYVVTTYEGTHSHX 68
                            59********************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.2E-31268IPR003657WRKY domain
SuperFamilySSF1182903.4E-28268IPR003657WRKY domain
PROSITE profilePS5081130.056570IPR003657WRKY domain
SMARTSM007742.8E-341069IPR003657WRKY domain
PfamPF031063.6E-251167IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 96 aa     Download sequence    Send to blast
FRTRTEIEIL DDGYKWRKYG KKSVKNSPNP RNYYRCSTEG CSVKKRVERD RDDPAYVVTT  60
YEGTHSHXXX XXXXXXXXXX XXXXXXXXXX XAHSTE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-25167874Probable WRKY transcription factor 4
2lex_A1e-25167874Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR8274021e-109KR827402.1 Triticum aestivum WRKY51 transcriptional factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003568011.12e-42PREDICTED: probable WRKY transcription factor 48
SwissprotQ8VWQ55e-38WRK50_ARATH; Probable WRKY transcription factor 50
TrEMBLM8BCQ22e-45M8BCQ2_AEGTA; Uncharacterized protein
STRINGMLOC_81131.12e-44(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44137206
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26170.13e-39WRKY DNA-binding protein 50